PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 112aa    MW: 12422.6 Da    PI: 10.7395
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042918genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.41.9e-281059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 ri+n++ rqvtfskRrng+lKKA+EL +LCda+v viifsstgkly++ss
  Lus10042918 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDADVGVIIFSSTGKLYDFSS 59
                 8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.286161IPR002100Transcription factor, MADS-box
SMARTSM004325.9E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.06E-28268IPR002100Transcription factor, MADS-box
CDDcd002653.24E-37260No hitNo description
PRINTSPR004042.2E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD ADVGVIIFSS TGKLYDFSSS  60
RLIGTANRKL FLGCAVVRDR CGKGSNESER EQIKLVEINY VPCVPRLRVC M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-16262161MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-16262161MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-16262161MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-16262161MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011627903.11e-34PREDICTED: MADS-box transcription factor 18-like
SwissprotA2RVQ53e-34AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLA0A068TXG08e-35A0A068TXG0_COFCA; Uncharacterized protein
TrEMBLA0A0L9UYB21e-34A0A0L9UYB2_PHAAN; Uncharacterized protein
TrEMBLW9RX212e-34W9RX21_9R
STRINGGLYMA02G38091.17e-33(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.12e-35AGAMOUS-like 16